Recombinant Human HMGB3, His-tagged

Cat.No. : HMGB3-105H
Product Overview : Recombinant Human High Mobility Group Protein B3/HMGB3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala2-Glu200) of Human HMGB3 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 2-200 a.a.
Description : High Mobility Group Protein B3 (HMGB3) belongs to the HMGB family. Members of the HMG box subfamily are thought to be have an important role in DNA replication, nucleosome assembly and transcription. HMGB3 binds preferentiallly single-stranded DNA and unwinds double stranded DNA. HMGB3 consists of 200 amino acids and is localized to the cell nucleus. It contains two HMG box DNA-binding domain. HMGB3 binds preferentially single-stranded DNA and unwinds double stranded DNA.
AA Sequence : MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAK ADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEM WNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEE EEEDEVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name HMGB3 high mobility group box 3 [ Homo sapiens ]
Official Symbol HMGB3
Synonyms HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a;
Gene ID 3149
mRNA Refseq NM_005342
Protein Refseq NP_005333
MIM 300193
UniProt ID O15347
Chromosome Location Xq28
Function DNA binding, bending; double-stranded DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGB3 Products

Required fields are marked with *

My Review for All HMGB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon