Recombinant Human HMGB3, His-tagged
Cat.No. : | HMGB3-105H |
Product Overview : | Recombinant Human High Mobility Group Protein B3/HMGB3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala2-Glu200) of Human HMGB3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 2-200 a.a. |
Description : | High Mobility Group Protein B3 (HMGB3) belongs to the HMGB family. Members of the HMG box subfamily are thought to be have an important role in DNA replication, nucleosome assembly and transcription. HMGB3 binds preferentiallly single-stranded DNA and unwinds double stranded DNA. HMGB3 consists of 200 amino acids and is localized to the cell nucleus. It contains two HMG box DNA-binding domain. HMGB3 binds preferentially single-stranded DNA and unwinds double stranded DNA. |
AA Sequence : | MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAK ADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEM WNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEE EEEDEVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | HMGB3 high mobility group box 3 [ Homo sapiens ] |
Official Symbol | HMGB3 |
Synonyms | HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a; |
Gene ID | 3149 |
mRNA Refseq | NM_005342 |
Protein Refseq | NP_005333 |
MIM | 300193 |
UniProt ID | O15347 |
Chromosome Location | Xq28 |
Function | DNA binding, bending; double-stranded DNA binding; |
◆ Recombinant Proteins | ||
HMGB3-105H | Recombinant Human HMGB3, His-tagged | +Inquiry |
HMGB3-4872H | Recombinant Human HMGB3 Protein, GST-tagged | +Inquiry |
HMGB3-7730M | Recombinant Mouse HMGB3 Protein | +Inquiry |
HMGB3-301335H | Recombinant Human HMGB3 protein, GST-tagged | +Inquiry |
HMGB3-6847C | Recombinant Chicken HMGB3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB3-801HCL | Recombinant Human HMGB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB3 Products
Required fields are marked with *
My Review for All HMGB3 Products
Required fields are marked with *