Recombinant Human HMOX1 protein, His-tagged
Cat.No. : | HMOX1-6746H |
Product Overview : | Recombinant Human HMOX1 protein(151-288 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 151-288 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | AQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
Gene Name | HMOX1 heme oxygenase (decycling) 1 [ Homo sapiens ] |
Official Symbol | HMOX1 |
Synonyms | HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; bK286B10; HO 1; heat shock protein, 32-kD; HO-1; HSP32; |
Gene ID | 3162 |
mRNA Refseq | NM_002133 |
Protein Refseq | NP_002124 |
MIM | 141250 |
UniProt ID | P09601 |
◆ Recombinant Proteins | ||
HMOX1-27002TH | Recombinant Human HMOX1 | +Inquiry |
HMOX1-1556H | Recombinant Human HMOX1 protein, His-tagged | +Inquiry |
HMOX1-6896C | Recombinant Chicken HMOX1 | +Inquiry |
HMOX1-061H | Recombinant Human HMOX1 Protein, His-tagged | +Inquiry |
HMOX1-3082H | Recombinant Human HMOX1 Protein (Met1-Thr261) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMOX1 Products
Required fields are marked with *
My Review for All HMOX1 Products
Required fields are marked with *