Recombinant Human HMOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HMOX1-5723H |
Product Overview : | HMOX1 MS Standard C13 and N15-labeled recombinant protein (NP_002124) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQHYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HMOX1 heme oxygenase 1 [ Homo sapiens (human) ] |
Official Symbol | HMOX1 |
Synonyms | HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; bK286B10; HO 1; heat shock protein, 32-kD; HO-1; HSP32; |
Gene ID | 3162 |
mRNA Refseq | NM_002133 |
Protein Refseq | NP_002124 |
MIM | 141250 |
UniProt ID | P09601 |
◆ Recombinant Proteins | ||
HMOX1-1083H | Recombinant Human HMOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hmox1-2605M | Recombinant Mouse Hmox1 protein, His & S-tagged | +Inquiry |
HMOX1-7743M | Recombinant Mouse HMOX1 Protein | +Inquiry |
HMOX1-3040H | Recombinant Human HMOX1 protein, His-tagged | +Inquiry |
HMOX1-27002TH | Recombinant Human HMOX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMOX1 Products
Required fields are marked with *
My Review for All HMOX1 Products
Required fields are marked with *