Recombinant Human HNMT protein(1-292 aa), His-tagged
| Cat.No. : | HNMT-13863H |
| Product Overview : | Recombinant Human HNMT protein(1-292 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | May 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-292 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
| Gene Name | HNMT histamine N-methyltransferase [ Homo sapiens ] |
| Official Symbol | HNMT |
| Synonyms | HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2; |
| Gene ID | 3176 |
| mRNA Refseq | NM_001024074 |
| Protein Refseq | NP_001019245 |
| MIM | 605238 |
| UniProt ID | P50135 |
| ◆ Recombinant Proteins | ||
| HNMT-2533R | Recombinant Rat HNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNMT-1937R | Recombinant Rhesus Macaque HNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNMT-13863H | Recombinant Human HNMT protein(1-292 aa), His-tagged | +Inquiry |
| HNMT-1058Z | Recombinant Zebrafish HNMT | +Inquiry |
| HNMT-3677HF | Recombinant Full Length Human HNMT Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNMT Products
Required fields are marked with *
My Review for All HNMT Products
Required fields are marked with *
