Recombinant Human HNRNPH1 protein(11-280 aa), C-His-tagged
| Cat.No. : | HNRNPH1-2722H |
| Product Overview : | Recombinant Human HNRNPH1 protein(P31943)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-280 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | FVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG |
| Gene Name | HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ] |
| Official Symbol | HNRNPH1 |
| Synonyms | HNRNPH1; heterogeneous nuclear ribonucleoprotein H1 (H); HNRPH1; heterogeneous nuclear ribonucleoprotein H; hnRNPH; HNRPH; DKFZp686A15170; |
| Gene ID | 3187 |
| mRNA Refseq | NM_001257293 |
| Protein Refseq | NP_001244222 |
| MIM | 601035 |
| UniProt ID | P31943 |
| ◆ Recombinant Proteins | ||
| HNRNPH1-1433H | Recombinant Human HNRNPH1 protein, His/SUMO-tagged | +Inquiry |
| HNRNPH1-11707Z | Recombinant Zebrafish HNRNPH1 | +Inquiry |
| HNRNPH1-40H | Recombinant Human HNRNPH1 Protein, His-tagged | +Inquiry |
| HNRNPH1-13871H | Recombinant Human HNRNPH1, His-tagged | +Inquiry |
| HNRNPH1-6066C | Recombinant Chicken HNRNPH1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPH1-5446HCL | Recombinant Human HNRNPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPH1 Products
Required fields are marked with *
My Review for All HNRNPH1 Products
Required fields are marked with *



