Recombinant Human HNRNPH1 protein(11-280 aa), C-His-tagged
Cat.No. : | HNRNPH1-2722H |
Product Overview : | Recombinant Human HNRNPH1 protein(P31943)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG |
Gene Name | HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ] |
Official Symbol | HNRNPH1 |
Synonyms | HNRNPH1; heterogeneous nuclear ribonucleoprotein H1 (H); HNRPH1; heterogeneous nuclear ribonucleoprotein H; hnRNPH; HNRPH; DKFZp686A15170; |
Gene ID | 3187 |
mRNA Refseq | NM_001257293 |
Protein Refseq | NP_001244222 |
MIM | 601035 |
UniProt ID | P31943 |
◆ Recombinant Proteins | ||
HNRNPH1-01H | Recombinant Human HNRNPH1 Protein, His-tagged | +Inquiry |
HNRNPH1-1433H | Recombinant Human HNRNPH1 protein, His/SUMO-tagged | +Inquiry |
HNRNPH1-2722H | Recombinant Human HNRNPH1 protein(11-280 aa), C-His-tagged | +Inquiry |
HNRNPH1-83HFL | Recombinant Full Length Human HNRNPH1 Protein, C-Flag-tagged | +Inquiry |
HNRNPH1-11707Z | Recombinant Zebrafish HNRNPH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPH1-5446HCL | Recombinant Human HNRNPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPH1 Products
Required fields are marked with *
My Review for All HNRNPH1 Products
Required fields are marked with *