Recombinant Human HNRNPH3 protein(11-170 aa), C-His-tagged
| Cat.No. : | HNRNPH3-2721H | 
| Product Overview : | Recombinant Human HNRNPH3 protein(P31942)(11-170 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 11-170 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | NDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRM | 
| Gene Name | HNRNPH3 heterogeneous nuclear ribonucleoprotein H3 (2H9) [ Homo sapiens ] | 
| Official Symbol | HNRNPH3 | 
| Synonyms | 2H9; HNRPH3 | 
| Gene ID | 3189 | 
| mRNA Refseq | NM_021644.3 | 
| Protein Refseq | NP_067676.2 | 
| MIM | 602324 | 
| UniProt ID | P31942 | 
| ◆ Recombinant Proteins | ||
| HNRNPH3-2125R | Recombinant Rhesus monkey HNRNPH3 Protein, His-tagged | +Inquiry | 
| HNRNPH3-3118H | Recombinant Human HNRNPH3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| HNRNPH3-1962C | Recombinant Chicken HNRNPH3 | +Inquiry | 
| HNRNPH3-3615HF | Recombinant Full Length Human HNRNPH3 Protein, GST-tagged | +Inquiry | 
| HNRNPH3-2721H | Recombinant Human HNRNPH3 protein(11-170 aa), C-His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HNRNPH3-5444HCL | Recombinant Human HNRNPH3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPH3 Products
Required fields are marked with *
My Review for All HNRNPH3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            