Recombinant Human HNRNPH3 protein(11-170 aa), C-His-tagged
Cat.No. : | HNRNPH3-2721H |
Product Overview : | Recombinant Human HNRNPH3 protein(P31942)(11-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRM |
Gene Name | HNRNPH3 heterogeneous nuclear ribonucleoprotein H3 (2H9) [ Homo sapiens ] |
Official Symbol | HNRNPH3 |
Synonyms | 2H9; HNRPH3 |
Gene ID | 3189 |
mRNA Refseq | NM_021644.3 |
Protein Refseq | NP_067676.2 |
MIM | 602324 |
UniProt ID | P31942 |
◆ Recombinant Proteins | ||
HNRNPH3-2125R | Recombinant Rhesus monkey HNRNPH3 Protein, His-tagged | +Inquiry |
HNRNPH3-1946R | Recombinant Rhesus Macaque HNRNPH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPH3-590H | Recombinant Human HNRNPH3 | +Inquiry |
HNRNPH3-3118H | Recombinant Human HNRNPH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPH3-3773Z | Recombinant Zebrafish HNRNPH3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPH3-5444HCL | Recombinant Human HNRNPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPH3 Products
Required fields are marked with *
My Review for All HNRNPH3 Products
Required fields are marked with *
0
Inquiry Basket