Recombinant Human HOMER2 protein, His-tagged
Cat.No. : | HOMER2-21H |
Product Overview : | Recombinant Human UBAP2L protein(Q14157)(Arg11-Thr170), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Arg11-Thr170 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 20 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSGGPSGRGT |
Gene Name | UBAP2L ubiquitin associated protein 2-like [ Homo sapiens ] |
Official Symbol | UBAP2L |
Synonyms | UBAP2L; ubiquitin associated protein 2-like; ubiquitin-associated protein 2-like; KIAA0144; NICE 4; protein NICE-4; NICE-4; FLJ42300; |
Gene ID | 9898 |
mRNA Refseq | NM_001127320 |
Protein Refseq | NP_001120792 |
UniProt ID | Q14157 |
◆ Recombinant Proteins | ||
HOMER2-2252H | Recombinant Human HOMER2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HOMER2-4269M | Recombinant Mouse HOMER2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOMER2-13880H | Recombinant Human HOMER2, GST-tagged | +Inquiry |
HOMER2-1697H | Recombinant Human HOMER2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HOMER2-5743H | Recombinant Human HOMER2 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOMER2-5437HCL | Recombinant Human HOMER2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOMER2 Products
Required fields are marked with *
My Review for All HOMER2 Products
Required fields are marked with *