Recombinant Human HOMER2 protein, His-tagged

• Cat.No.: HOMER2-21H
• Product Overview: Recombinant Human UBAP2L protein(Q14157)(Arg11-Thr170), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Arg11-Thr170
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 20 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSGGPSGRGT

Gene Information

• Gene Name: UBAP2L ubiquitin associated protein 2-like [ Homo sapiens ]
• Official Symbol: UBAP2L
• Synonyms: UBAP2L; ubiquitin associated protein 2-like; ubiquitin-associated protein 2-like; KIAA0144; NICE 4; protein NICE-4; NICE-4; FLJ42300
• Gene ID: 9898
• mRNA Refseq: NM_001127320
• Protein Refseq: NP_001120792
• UniProt ID: Q14157