Recombinant Human HOXA9 protein, T7/His-tagged
| Cat.No. : | HOXA9-162H |
| Product Overview : | Recombinant human HoxA9 cDNA (272aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAE HPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFA GLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPA ANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | HOXA9 homeobox A9 [ Homo sapiens ] |
| Official Symbol | HOXA9 |
| Synonyms | HOXA9; homeobox A9; homeo box A9 , HOX1, HOX1G; homeobox protein Hox-A9; homeobox protein Hox-1G; homeodomain protein HOXA9; HOX1; ABD-B; HOX1G; HOX1.7; MGC1934; |
| Gene ID | 3205 |
| mRNA Refseq | NM_152739 |
| Protein Refseq | NP_689952 |
| MIM | 142956 |
| UniProt ID | P31269 |
| Chromosome Location | 7p15.2 |
| Pathway | TGF-beta Receptor Signaling Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| HOXA9-1990HFL | Recombinant Full Length Human HOXA9 Protein, C-Flag-tagged | +Inquiry |
| HOXA9-4284M | Recombinant Mouse HOXA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HOXA9-174H | Recombinant Human HOXA9, His-tagged | +Inquiry |
| HOXA9-4952H | Recombinant Human HOXA9 Protein, GST-tagged | +Inquiry |
| HOXA9-162H | Recombinant Human HOXA9 protein, T7/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXA9-335HCL | Recombinant Human HOXA9 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA9 Products
Required fields are marked with *
My Review for All HOXA9 Products
Required fields are marked with *
