Recombinant Human HOXC5

Cat.No. : HOXC5-29379TH
Product Overview : Recombinant fragment of Human HOXC5 with N terminal proprietary tag. Predicted MW 33.11 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 68 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesnt encode a protein. The protein-coding transcript variant contains gene-specific exons only.
Molecular Weight : 33.110kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXC5 homeobox C5 [ Homo sapiens ]
Official Symbol HOXC5
Synonyms HOXC5; homeobox C5; homeo box C5 , HOX3, HOX3D; homeobox protein Hox-C5;
Gene ID 3222
mRNA Refseq NM_018953
Protein Refseq NP_061826
MIM 142973
Uniprot ID Q00444
Chromosome Location 12q13.13
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC5 Products

Required fields are marked with *

My Review for All HOXC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon