Recombinant Human HOXC5
Cat.No. : | HOXC5-29379TH |
Product Overview : | Recombinant fragment of Human HOXC5 with N terminal proprietary tag. Predicted MW 33.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 68 amino acids |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesnt encode a protein. The protein-coding transcript variant contains gene-specific exons only. |
Molecular Weight : | 33.110kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR |
Sequence Similarities : | Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXC5 homeobox C5 [ Homo sapiens ] |
Official Symbol | HOXC5 |
Synonyms | HOXC5; homeobox C5; homeo box C5 , HOX3, HOX3D; homeobox protein Hox-C5; |
Gene ID | 3222 |
mRNA Refseq | NM_018953 |
Protein Refseq | NP_061826 |
MIM | 142973 |
Uniprot ID | Q00444 |
Chromosome Location | 12q13.13 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXC5-4981H | Recombinant Human HOXC5 Protein, GST-tagged | +Inquiry |
HOXC5-29379TH | Recombinant Human HOXC5 | +Inquiry |
HOXC5-4293M | Recombinant Mouse HOXC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXC5-7809M | Recombinant Mouse HOXC5 Protein | +Inquiry |
HOXC5-3727HF | Recombinant Full Length Human HOXC5 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC5 Products
Required fields are marked with *
My Review for All HOXC5 Products
Required fields are marked with *
0
Inquiry Basket