Recombinant Human HOXC6
Cat.No. : | HOXC6-29377TH |
Product Overview : | Recombinant full length Human HoxC6 with N terminal proprietary tag; Predicted MW 51.92 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 235 amino acids |
Description : | This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. |
Molecular Weight : | 51.920kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTY GAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQE KDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEF HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
Sequence Similarities : | Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXC6 homeobox C6 [ Homo sapiens ] |
Official Symbol | HOXC6 |
Synonyms | HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6; |
Gene ID | 3223 |
mRNA Refseq | NM_004503 |
Protein Refseq | NP_004494 |
MIM | 142972 |
Uniprot ID | P09630 |
Chromosome Location | 12q13.13 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
HOXC6-29380TH | Recombinant Human HOXC6 | +Inquiry |
HOXC6-13907H | Recombinant Human HOXC6, GST-tagged | +Inquiry |
HOXC6-1598H | Recombinant Human HOXC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HOXC6-094H | Recombinant Human HOXC6 Protein, HIS-tagged | +Inquiry |
HOXC6-3728HF | Recombinant Full Length Human HOXC6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXC6-5415HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXC6 Products
Required fields are marked with *
My Review for All HOXC6 Products
Required fields are marked with *
0
Inquiry Basket