Recombinant Human HOXD10 Protein, GST-tagged

Cat.No. : HOXD10-4990H
Product Overview : Human HOXD10 full-length ORF ( NP_002139.2, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilms tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq
Molecular Mass : 64.8 kDa
AA Sequence : MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXD10 homeobox D10 [ Homo sapiens ]
Official Symbol HOXD10
Synonyms HOXD10; homeobox D10; homeo box D10 , HOX4, HOX4D; homeobox protein Hox-D10; homeo box 4D; homeo box D10; homeobox protein Hox-4D; homeobox protein Hox-4E; HOX4; HOX4D; HOX4E; Hox-4.4;
Gene ID 3236
mRNA Refseq NM_002148
Protein Refseq NP_002139
MIM 142984
UniProt ID P28358

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXD10 Products

Required fields are marked with *

My Review for All HOXD10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon