Recombinant Human HOXD10

Cat.No. : HOXD10-26460TH
Product Overview : Recombinant fragment corresponding to amino acids 44-143 of Human HOXD10 with N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilms tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Strongly expressed in the adult male and female urogenital tracts.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVEN
Sequence Similarities : Belongs to the Abd-B homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXD10 homeobox D10 [ Homo sapiens ]
Official Symbol HOXD10
Synonyms HOXD10; homeobox D10; homeo box D10 , HOX4, HOX4D; homeobox protein Hox-D10;
Gene ID 3236
mRNA Refseq NM_002148
Protein Refseq NP_002139
MIM 142984
Uniprot ID P28358
Chromosome Location 2q31.1
Function chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXD10 Products

Required fields are marked with *

My Review for All HOXD10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon