Recombinant Human HOXD10
Cat.No. : | HOXD10-26460TH |
Product Overview : | Recombinant fragment corresponding to amino acids 44-143 of Human HOXD10 with N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilms tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Strongly expressed in the adult male and female urogenital tracts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVEN |
Sequence Similarities : | Belongs to the Abd-B homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXD10 homeobox D10 [ Homo sapiens ] |
Official Symbol | HOXD10 |
Synonyms | HOXD10; homeobox D10; homeo box D10 , HOX4, HOX4D; homeobox protein Hox-D10; |
Gene ID | 3236 |
mRNA Refseq | NM_002148 |
Protein Refseq | NP_002139 |
MIM | 142984 |
Uniprot ID | P28358 |
Chromosome Location | 2q31.1 |
Function | chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXD10-4990H | Recombinant Human HOXD10 Protein, GST-tagged | +Inquiry |
HOXD10-3653H | Recombinant Human HOXD10 protein, GST-tagged | +Inquiry |
HOXD10-714H | Recombinant Human HOXD10 Protein, His-tagged | +Inquiry |
HOXD10-3732HF | Recombinant Full Length Human HOXD10 Protein, GST-tagged | +Inquiry |
HOXD10-26460TH | Recombinant Human HOXD10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD10-5412HCL | Recombinant Human HOXD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXD10 Products
Required fields are marked with *
My Review for All HOXD10 Products
Required fields are marked with *
0
Inquiry Basket