Recombinant Human HOXD10 protein, GST-tagged
| Cat.No. : | HOXD10-3653H |
| Product Overview : | Recombinant Human HOXD10 protein(163-247 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 163-247 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | TQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKES |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HOXD10 homeobox D10 [ Homo sapiens ] |
| Official Symbol | HOXD10 |
| Synonyms | HOXD10; homeobox D10; homeo box D10 , HOX4, HOX4D; homeobox protein Hox-D10; homeo box 4D; homeo box D10; homeobox protein Hox-4D; homeobox protein Hox-4E; HOX4; HOX4D; HOX4E; Hox-4.4; |
| Gene ID | 3236 |
| mRNA Refseq | NM_002148 |
| Protein Refseq | NP_002139 |
| MIM | 142984 |
| UniProt ID | P28358 |
| ◆ Recombinant Proteins | ||
| HOXD10-714H | Recombinant Human HOXD10 Protein, His-tagged | +Inquiry |
| HOXD10-3653H | Recombinant Human HOXD10 protein, GST-tagged | +Inquiry |
| HOXD10-3732HF | Recombinant Full Length Human HOXD10 Protein, GST-tagged | +Inquiry |
| HOXD10-4990H | Recombinant Human HOXD10 Protein, GST-tagged | +Inquiry |
| HOXD10-26460TH | Recombinant Human HOXD10 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXD10-5412HCL | Recombinant Human HOXD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXD10 Products
Required fields are marked with *
My Review for All HOXD10 Products
Required fields are marked with *
