Recombinant Human HS1BP3 Protein, GST-tagged

Cat.No. : HS1BP3-5046H
Product Overview : Human HS1BP3 full-length ORF ( AAH27947, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. [provided by RefSeq
Molecular Mass : 49.17 kDa
AA Sequence : MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HS1BP3 HCLS1 binding protein 3 [ Homo sapiens ]
Official Symbol HS1BP3
Synonyms HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3;
Gene ID 64342
mRNA Refseq NM_022460
Protein Refseq NP_071905
MIM 609359
UniProt ID Q53T59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HS1BP3 Products

Required fields are marked with *

My Review for All HS1BP3 Products

Required fields are marked with *

0
cart-icon