Recombinant Human HSCB Protein, GST-tagged

Cat.No. : HSCB-5059H
Product Overview : Human HSCB full-length ORF ( NP_741999.3, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Molecular Mass : 53.8 kDa
AA Sequence : MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSCB HscB iron-sulfur cluster co-chaperone homolog (E. coli) [ Homo sapiens ]
Official Symbol HSCB
Synonyms HSCB; HscB iron-sulfur cluster co-chaperone homolog (E. coli); JAC1; HSC20; DNAJC20; dJ366L4.2; iron-sulfur cluster co-chaperone protein HscB, mitochondrial; J-type co-chaperone HSC20; dnaJ homolog subfamily C member 20; DnaJ (Hsp40) homolog, subfamily C, member 20; Jac1
Gene ID 150274
mRNA Refseq NM_172002
Protein Refseq NP_741999
MIM 608142
UniProt ID Q8IWL3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSCB Products

Required fields are marked with *

My Review for All HSCB Products

Required fields are marked with *

0
cart-icon