Recombinant Human HSCB Protein, GST-tagged
Cat.No. : | HSCB-5059H |
Product Overview : | Human HSCB full-length ORF ( NP_741999.3, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSCB HscB iron-sulfur cluster co-chaperone homolog (E. coli) [ Homo sapiens ] |
Official Symbol | HSCB |
Synonyms | HSCB; HscB iron-sulfur cluster co-chaperone homolog (E. coli); JAC1; HSC20; DNAJC20; dJ366L4.2; iron-sulfur cluster co-chaperone protein HscB, mitochondrial; J-type co-chaperone HSC20; dnaJ homolog subfamily C member 20; DnaJ (Hsp40) homolog, subfamily C, member 20; Jac1 |
Gene ID | 150274 |
mRNA Refseq | NM_172002 |
Protein Refseq | NP_741999 |
MIM | 608142 |
UniProt ID | Q8IWL3 |
◆ Recombinant Proteins | ||
HSCB-2150R | Recombinant Rhesus monkey HSCB Protein, His-tagged | +Inquiry |
HSCB-5059H | Recombinant Human HSCB Protein, GST-tagged | +Inquiry |
HSCB-4329M | Recombinant Mouse HSCB Protein, His (Fc)-Avi-tagged | +Inquiry |
HSCB-5456H | Recombinant Human HSCB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hscb-169M | Recombinant Mouse Hscb Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSCB-5382HCL | Recombinant Human HSCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSCB Products
Required fields are marked with *
My Review for All HSCB Products
Required fields are marked with *
0
Inquiry Basket