Recombinant Human HSD11B1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HSD11B1-1415H |
| Product Overview : | HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein. |
| Molecular Mass : | 32.4 kDa |
| AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HSD11B1 hydroxysteroid 11-beta dehydrogenase 1 [ Homo sapiens (human) ] |
| Official Symbol | HSD11B1 |
| Synonyms | HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539; |
| Gene ID | 3290 |
| mRNA Refseq | NM_181755 |
| Protein Refseq | NP_861420 |
| MIM | 600713 |
| UniProt ID | P28845 |
| ◆ Recombinant Proteins | ||
| HSD11B1-1099H | Recombinant Human HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSD11B1-4330M | Recombinant Mouse HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSD11B1-2920R | Recombinant Rat HSD11B1 Protein | +Inquiry |
| HSD11B1-065H | Active Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
| Hsd11b1-476R | Recombinant Rat Hsd11b1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
| HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
