Recombinant Human HSD17B12 protein, His-tagged
Cat.No. : | HSD17B12-2821H |
Product Overview : | Recombinant Human HSD17B12 protein(203 - 271 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 203 - 271 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [ Homo sapiens ] |
Official Symbol | HSD17B12 |
Synonyms | HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; estradiol 17-beta-dehydrogenase 12; 3 ketoacyl CoA reductase; KAR; SDR12C1; short chain dehydrogenase/reductase family 12C; member 1; 17-beta-HSD 12; 17beta-HSD type 12; 3-ketoacyl-CoA reductase; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; short chain dehydrogenase/reductase family 12C, member 1; |
Gene ID | 51144 |
mRNA Refseq | NM_016142 |
Protein Refseq | NP_057226 |
MIM | 609574 |
UniProt ID | Q53GQ0 |
◆ Recombinant Proteins | ||
HSD17B12-7874M | Recombinant Mouse HSD17B12 Protein | +Inquiry |
Hsd17b12-1410M | Recombinant Mouse Hsd17b12 protein, His & GST-tagged | +Inquiry |
HSD17B12-599C | Recombinant Cynomolgus HSD17B12 Protein, His-tagged | +Inquiry |
HSD17B12-345C | Recombinant Cynomolgus Monkey HSD17B12 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B12-47H | Recombinant Human HSD17B12, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B12-818HCL | Recombinant Human HSD17B12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B12 Products
Required fields are marked with *
My Review for All HSD17B12 Products
Required fields are marked with *