Recombinant Human HSD17B12 protein, His-tagged

Cat.No. : HSD17B12-2821H
Product Overview : Recombinant Human HSD17B12 protein(203 - 271 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203 - 271 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [ Homo sapiens ]
Official Symbol HSD17B12
Synonyms HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; estradiol 17-beta-dehydrogenase 12; 3 ketoacyl CoA reductase; KAR; SDR12C1; short chain dehydrogenase/reductase family 12C; member 1; 17-beta-HSD 12; 17beta-HSD type 12; 3-ketoacyl-CoA reductase; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; short chain dehydrogenase/reductase family 12C, member 1;
Gene ID 51144
mRNA Refseq NM_016142
Protein Refseq NP_057226
MIM 609574
UniProt ID Q53GQ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B12 Products

Required fields are marked with *

My Review for All HSD17B12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon