Recombinant Human HSD17B12 protein, His-tagged

• Cat.No.: HSD17B12-2821H
• Product Overview: Recombinant Human HSD17B12 protein(203 - 271 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 203 - 271 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [ Homo sapiens ]
• Official Symbol: HSD17B12
• Synonyms: HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; estradiol 17-beta-dehydrogenase 12; 3 ketoacyl CoA reductase; KAR; SDR12C1; short chain dehydrogenase/reductase family 12C; member 1; 17-beta-HSD 12; 17beta-HSD type 12; 3-ketoacyl-CoA reductase; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; short chain dehydrogenase/reductase family 12C, member 1
• Gene ID: 51144
• mRNA Refseq: NM_016142
• Protein Refseq: NP_057226
• MIM: 609574
• UniProt ID: Q53GQ0