Recombinant Human HSD17B8 Protein, GST-tagged

Cat.No. : HSD17B8-5076H
Product Overview : Human HSD17B8 full-length ORF ( NP_055049.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq
Molecular Mass : 53.4 kDa
AA Sequence : MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B8 hydroxysteroid (17-beta) dehydrogenase 8 [ Homo sapiens ]
Official Symbol HSD17B8
Synonyms HSD17B8; hydroxysteroid (17-beta) dehydrogenase 8; FabG (beta ketoacyl [acyl carrier protein] reductase, E coli) like (E. coli) , FABGL; estradiol 17-beta-dehydrogenase 8; D6S2245E; H2 KE6; HKE6; KE6; RING2; SDR30C1; short chain dehydrogenase/reductase family 30C; member 1; ke-6; protein Ke6; 17-beta-HSD 8; estrogen 17-oxidoreductase; testosterone 17-beta-dehydrogenase 8; really interesting new gene 2 protein; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase; short chain dehydrogenase/reductase family 30C, member 1; FABG; FABGL; H2-KE6; dJ1033B10.9;
Gene ID 7923
mRNA Refseq NM_014234
Protein Refseq NP_055049
MIM 601417
UniProt ID Q92506

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B8 Products

Required fields are marked with *

My Review for All HSD17B8 Products

Required fields are marked with *

0
cart-icon