Recombinant Human HSD17B8 Protein, GST-tagged
| Cat.No. : | HSD17B8-5076H |
| Product Overview : | Human HSD17B8 full-length ORF ( NP_055049.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq |
| Molecular Mass : | 53.4 kDa |
| AA Sequence : | MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSD17B8 hydroxysteroid (17-beta) dehydrogenase 8 [ Homo sapiens ] |
| Official Symbol | HSD17B8 |
| Synonyms | HSD17B8; hydroxysteroid (17-beta) dehydrogenase 8; FabG (beta ketoacyl [acyl carrier protein] reductase, E coli) like (E. coli) , FABGL; estradiol 17-beta-dehydrogenase 8; D6S2245E; H2 KE6; HKE6; KE6; RING2; SDR30C1; short chain dehydrogenase/reductase family 30C; member 1; ke-6; protein Ke6; 17-beta-HSD 8; estrogen 17-oxidoreductase; testosterone 17-beta-dehydrogenase 8; really interesting new gene 2 protein; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase; short chain dehydrogenase/reductase family 30C, member 1; FABG; FABGL; H2-KE6; dJ1033B10.9; |
| Gene ID | 7923 |
| mRNA Refseq | NM_014234 |
| Protein Refseq | NP_055049 |
| MIM | 601417 |
| UniProt ID | Q92506 |
| ◆ Recombinant Proteins | ||
| HSD17B8-13964H | Recombinant Human HSD17B8, GST-tagged | +Inquiry |
| HSD17B8-603C | Recombinant Cynomolgus HSD17B8 Protein, His-tagged | +Inquiry |
| HSD17B8-1069HFL | Recombinant Full Length Human HSD17B8 Protein, C-Flag-tagged | +Inquiry |
| HSD17B8-29342TH | Recombinant Human HSD17B8, His-tagged | +Inquiry |
| HSD17B8-2586R | Recombinant Rat HSD17B8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD17B8-5371HCL | Recombinant Human HSD17B8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B8 Products
Required fields are marked with *
My Review for All HSD17B8 Products
Required fields are marked with *
