Recombinant Human HSF4 Protein, GST-tagged

Cat.No. : HSF4-5091H
Product Overview : Human HSF4 partial ORF ( NP_001529, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSF4 heat shock transcription factor 4 [ Homo sapiens ]
Official Symbol HSF4
Synonyms HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4; HSF 4; hHSF4; HSTF 4; CTM;
Gene ID 3299
mRNA Refseq NM_001040667
Protein Refseq NP_001035757
MIM 602438
UniProt ID Q9ULV5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSF4 Products

Required fields are marked with *

My Review for All HSF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon