Recombinant Human HSF4 Protein, GST-tagged
| Cat.No. : | HSF4-5091H |
| Product Overview : | Human HSF4 partial ORF ( NP_001529, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSF4 heat shock transcription factor 4 [ Homo sapiens ] |
| Official Symbol | HSF4 |
| Synonyms | HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4; HSF 4; hHSF4; HSTF 4; CTM; |
| Gene ID | 3299 |
| mRNA Refseq | NM_001040667 |
| Protein Refseq | NP_001035757 |
| MIM | 602438 |
| UniProt ID | Q9ULV5 |
| ◆ Recombinant Proteins | ||
| HSF4-4064C | Recombinant Chicken HSF4 | +Inquiry |
| HSF4-2111Z | Recombinant Zebrafish HSF4 | +Inquiry |
| Hsf4-5664R | Recombinant Rat Hsf4 protein, His & T7-tagged | +Inquiry |
| HSF4-2675H | Recombinant Human HSF4 Protein (Val171-Arg284), N-GST tagged | +Inquiry |
| HSF4-716H | Recombinant Human HSF4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSF4-821HCL | Recombinant Human HSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF4 Products
Required fields are marked with *
My Review for All HSF4 Products
Required fields are marked with *
