Recombinant Human HSP90AA1, His-tagged
| Cat.No. : | HSP90AA1-27845TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 577-732 of Human Hsp90 alpha with N terminal His tag; MWt 18kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 577-732 a.a. |
| Description : | HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219) (Chen et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 103 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKA QALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADK NDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMI KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEE VD |
| Sequence Similarities : | Belongs to the heat shock protein 90 family. |
| Gene Name | HSP90AA1 heat shock protein 90kDa alpha (cytosolic), class A member 1 [ Homo sapiens ] |
| Official Symbol | HSP90AA1 |
| Synonyms | HSP90AA1; heat shock protein 90kDa alpha (cytosolic), class A member 1; heat shock 90kD protein 1, alpha , heat shock 90kDa protein 1, alpha , HSPC1, HSPCA; heat shock protein HSP 90-alpha; FLJ31884; Hsp89; Hsp90; HSP90N; |
| Gene ID | 3320 |
| mRNA Refseq | NM_001017963 |
| Protein Refseq | NP_001017963 |
| MIM | 140571 |
| Uniprot ID | P07900 |
| Chromosome Location | 14q32.33 |
| Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Axon guidance, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; |
| Function | ATP binding; ATP binding; ATPase activity; TPR domain binding; TPR domain binding; |
| ◆ Recombinant Proteins | ||
| HSP90AA1-1113H | Recombinant Human HSP90AA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSP90AA1-350C | Recombinant Cynomolgus Monkey HSP90AA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSP90AA1-047H | Recombinant Human HSP90AA1 Protein, N-6×His-tagged | +Inquiry |
| HSP90AA1-3097H | Recombinant Human HSP90AA1 protein(Glu535-Asp732) | +Inquiry |
| HSP90AA1-27844TH | Recombinant Human HSP90AA1, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSP90AA1-5362HCL | Recombinant Human HSP90AA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSP90AA1 Products
Required fields are marked with *
My Review for All HSP90AA1 Products
Required fields are marked with *
