Recombinant Human HSP90B1, His-tagged
Cat.No. : | HSP90B1-27413TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 341-803 of Human GRP94 with N terminal His tag; 463 amino acids, 57kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341-803 a.a. |
Description : | HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. HSP90B1 is an endoplasmic reticulum HSP90 protein. Other HSP90 proteins are found in cytosol (see HSP90AA1; MIM 140571) and mitochondria (TRAP1; MIM 606219) (Chen et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | PIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGE VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFI TDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLK VIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGV IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEK QDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDE YCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVE KEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVAS QYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPR HPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYL LPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEET AEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL |
Sequence Similarities : | Belongs to the heat shock protein 90 family. |
Gene Name | HSP90B1 heat shock protein 90kDa beta (Grp94), member 1 [ Homo sapiens ] |
Official Symbol | HSP90B1 |
Synonyms | HSP90B1; heat shock protein 90kDa beta (Grp94), member 1; TRA1, tumor rejection antigen (gp96) 1; endoplasmin; GP96; GRP94; |
Gene ID | 7184 |
mRNA Refseq | NM_003299 |
Protein Refseq | NP_003290 |
MIM | 191175 |
Uniprot ID | P14625 |
Chromosome Location | 12q24.2-q24.3 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; IL6-mediated signaling events, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; |
Function | ATP binding; RNA binding; calcium ion binding; low-density lipoprotein particle receptor binding; nucleotide binding; |
◆ Recombinant Proteins | ||
HSP90B1-07H | Recombinant Human Heat Shock Protein 90kDa Beta (Grp94), Member 1 | +Inquiry |
HSP90B1-7779H | Recombinant Human HSP90B1 protein, His & T7-tagged | +Inquiry |
HSP90B1-7899M | Recombinant Mouse Hsp90b1 protein, His/myc-tagged | +Inquiry |
HSP90B1-351C | Recombinant Cynomolgus Monkey HSP90B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSP90B1-4761H | Recombinant Human HSP90B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90B1-5360HCL | Recombinant Human HSP90B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSP90B1 Products
Required fields are marked with *
My Review for All HSP90B1 Products
Required fields are marked with *