Recombinant Human HSPB1 Protein, Tag Free
Cat.No. : | HSPB1-1553H |
Product Overview : | Recombinant human Hsp27 (1-205aa) was overexpressed in E. coli and purified by conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | Non |
Protein Length : | 1-205aa |
Form : | Liquid |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 20mM HEPES buffer (pH 7.4) containing 100mM KCl, 1mM DTT |
AA Sequence : | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Official Symbol | HSPB1 |
Synonyms | HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322 |
Gene ID | 3315 |
mRNA Refseq | NM_001540 |
Protein Refseq | NP_001531 |
MIM | 602195 |
UniProt ID | P04792 |
◆ Recombinant Proteins | ||
HSPB1-7913M | Recombinant Mouse HSPB1 Protein | +Inquiry |
Hspb1-814M | Recombinant Mouse Hspb1 protein, His-tagged | +Inquiry |
HSPB1-017H | Recombinant Human HSPB1 Protein, His-tagged | +Inquiry |
HSPB1-2167R | Recombinant Rhesus monkey HSPB1 Protein, His-tagged | +Inquiry |
HSPB1-2509HFL | Recombinant Full Length Human HSPB1 protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
HSPB1-1553H | Recombinant Human HSPB1 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB1-5351HCL | Recombinant Human HSPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPB1 Products
Required fields are marked with *
My Review for All HSPB1 Products
Required fields are marked with *
0
Inquiry Basket