Recombinant Human HSPB1 Protein, Tag Free

Cat.No. : HSPB1-1553H
Product Overview : Recombinant human Hsp27 (1-205aa) was overexpressed in E. coli and purified by conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : Non
Protein Length : 1-205aa
Form : Liquid
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM HEPES buffer (pH 7.4) containing 100mM KCl, 1mM DTT
AA Sequence : MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Endotoxin : <1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Concentration : 1 mg/mL (determined by Bradford assay)
Official Symbol HSPB1
Synonyms HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322
Gene ID 3315
mRNA Refseq NM_001540
Protein Refseq NP_001531
MIM 602195
UniProt ID P04792

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB1 Products

Required fields are marked with *

My Review for All HSPB1 Products

Required fields are marked with *

0
cart-icon