Recombinant Human HSPB1 Protein, Tag Free

• Cat.No.: HSPB1-1553H
• Product Overview: Recombinant human Hsp27 (1-205aa) was overexpressed in E. coli and purified by conventional chromatography.

Specification

• Species: Human
• Source: E. coli
• Tag: Non
• Protein Length: 1-205aa
• Form: Liquid
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: 20mM HEPES buffer (pH 7.4) containing 100mM KCl, 1mM DTT
• AA Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
• Endotoxin: <1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Concentration: 1 mg/mL (determined by Bradford assay)

Gene Information

• Official Symbol: HSPB1
• Synonyms: HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322
• Gene ID: 3315
• mRNA Refseq: NM_001540
• Protein Refseq: NP_001531
• MIM: 602195
• UniProt ID: P04792