Recombinant Human HSPB11 Protein, GST-tagged
Cat.No. : | HSPB11-5115H |
Product Overview : | Human HSPB11 full-length ORF (AAH05245.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HSPB11 (Heat Shock Protein Family B (Small) Member 11) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Intraflagellar transport. |
Molecular Mass : | 42.24 kDa |
AA Sequence : | MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ] |
Official Symbol | HSPB11 |
Synonyms | HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25; placental protein 25; intraflagellar transport 25 homolog; C1orf41; |
Gene ID | 51668 |
mRNA Refseq | NM_016126 |
Protein Refseq | NP_057210 |
UniProt ID | Q9Y547 |
◆ Recombinant Proteins | ||
HSPB11-3965HF | Recombinant Full Length Human HSPB11 Protein, GST-tagged | +Inquiry |
HSPB11-1989R | Recombinant Rhesus Macaque HSPB11 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB11-2168R | Recombinant Rhesus monkey HSPB11 Protein, His-tagged | +Inquiry |
HSPB11-27165TH | Recombinant Human HSPB11 | +Inquiry |
HSPB11-27166TH | Recombinant Human HSPB11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB11-5350HCL | Recombinant Human HSPB11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB11 Products
Required fields are marked with *
My Review for All HSPB11 Products
Required fields are marked with *
0
Inquiry Basket