Recombinant Human HSPB11 Protein, GST-tagged
| Cat.No. : | HSPB11-5115H |
| Product Overview : | Human HSPB11 full-length ORF (AAH05245.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HSPB11 (Heat Shock Protein Family B (Small) Member 11) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Intraflagellar transport. |
| Molecular Mass : | 42.24 kDa |
| AA Sequence : | MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ] |
| Official Symbol | HSPB11 |
| Synonyms | HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25; placental protein 25; intraflagellar transport 25 homolog; C1orf41; |
| Gene ID | 51668 |
| mRNA Refseq | NM_016126 |
| Protein Refseq | NP_057210 |
| UniProt ID | Q9Y547 |
| ◆ Recombinant Proteins | ||
| HSPB11-5115H | Recombinant Human HSPB11 Protein, GST-tagged | +Inquiry |
| HSPB11-2168R | Recombinant Rhesus monkey HSPB11 Protein, His-tagged | +Inquiry |
| HSPB11-7914M | Recombinant Mouse HSPB11 Protein | +Inquiry |
| HSPB11-27166TH | Recombinant Human HSPB11, His-tagged | +Inquiry |
| HSPB11-27165TH | Recombinant Human HSPB11 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB11-5350HCL | Recombinant Human HSPB11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB11 Products
Required fields are marked with *
My Review for All HSPB11 Products
Required fields are marked with *
