Recombinant Human HSPB11 Protein, GST-tagged

• Cat.No.: HSPB11-5115H
• Product Overview: Human HSPB11 full-length ORF (AAH05245.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HSPB11 (Heat Shock Protein Family B (Small) Member 11) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Intraflagellar transport.
• Molecular Mass: 42.24 kDa
• AA Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ]
• Official Symbol: HSPB11
• Synonyms: HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25; placental protein 25; intraflagellar transport 25 homolog; C1orf41
• Gene ID: 51668
• mRNA Refseq: NM_016126
• Protein Refseq: NP_057210
• UniProt ID: Q9Y547