Recombinant Human HSPB8 Protein, GST-tagged
| Cat.No. : | HSPB8-5120H |
| Product Overview : | Human HSPB8 full-length ORF ( AAH02673.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq |
| Molecular Mass : | 47.30 kDa |
| AA Sequence : | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPB8 heat shock 22kDa protein 8 [ Homo sapiens ] |
| Official Symbol | HSPB8 |
| Synonyms | HSPB8; heat shock 22kDa protein 8; heat shock 27kDa protein 8; heat shock protein beta-8; E2IG1; H11; HSP22; HspB8; protein kinase H11; alpha-crystallin C chain; E2-induced gene 1 protein; small stress protein-like protein HSP22; HMN2; CMT2L; DHMN2; HMN2A; |
| Gene ID | 26353 |
| mRNA Refseq | NM_014365 |
| Protein Refseq | NP_055180 |
| MIM | 608014 |
| UniProt ID | Q9UJY1 |
| ◆ Recombinant Proteins | ||
| HSPB8-5907Z | Recombinant Zebrafish HSPB8 | +Inquiry |
| HSPB8-1991R | Recombinant Rhesus Macaque HSPB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSPB8-1254H | Recombinant Human Heat Shock 22kDa Protein 8 | +Inquiry |
| HSPB8-2025H | Recombinant Human Heat Shock 22kDa Protein 8, His-tagged | +Inquiry |
| HSPB8-4366M | Recombinant Mouse HSPB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB8-5345HCL | Recombinant Human HSPB8 293 Cell Lysate | +Inquiry |
| HSPB8-011HKCL | Human HSPB8 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB8 Products
Required fields are marked with *
My Review for All HSPB8 Products
Required fields are marked with *



