Recombinant Human HSPB8 Protein, GST-tagged

Cat.No. : HSPB8-5120H
Product Overview : Human HSPB8 full-length ORF ( AAH02673.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq
Molecular Mass : 47.30 kDa
AA Sequence : MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPB8 heat shock 22kDa protein 8 [ Homo sapiens ]
Official Symbol HSPB8
Synonyms HSPB8; heat shock 22kDa protein 8; heat shock 27kDa protein 8; heat shock protein beta-8; E2IG1; H11; HSP22; HspB8; protein kinase H11; alpha-crystallin C chain; E2-induced gene 1 protein; small stress protein-like protein HSP22; HMN2; CMT2L; DHMN2; HMN2A;
Gene ID 26353
mRNA Refseq NM_014365
Protein Refseq NP_055180
MIM 608014
UniProt ID Q9UJY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB8 Products

Required fields are marked with *

My Review for All HSPB8 Products

Required fields are marked with *

0
cart-icon