Recombinant Human HSPB9 Protein, GST-tagged
| Cat.No. : | HSPB9-5123H |
| Product Overview : | Human HSPB9 full-length ORF ( NP_149971.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HSPB9 (Heat Shock Protein Family B (Small) Member 9) is a Protein Coding gene. |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPB9 heat shock protein, alpha-crystallin-related, B9 [ Homo sapiens ] |
| Official Symbol | HSPB9 |
| Synonyms | HSPB9; heat shock protein, alpha-crystallin-related, B9; heat shock protein beta-9; cancer/testis antigen 51; CT51; small heat shock protein B9; FLJ27437; |
| Gene ID | 94086 |
| mRNA Refseq | NM_033194 |
| Protein Refseq | NP_149971 |
| MIM | 608344 |
| UniProt ID | Q9BQS6 |
| ◆ Recombinant Proteins | ||
| HSPB9-5581H | Recombinant Human Heat Shock Protein, Alpha-crystallin-related, B9, His-tagged | +Inquiry |
| Hspb9-3458M | Recombinant Mouse Hspb9 Protein, Myc/DDK-tagged | +Inquiry |
| Hspb9-1640M | Recombinant Mouse Hspb9 Protein, His-tagged | +Inquiry |
| HSPB9-2260H | Recombinant Human HSPB9 Protein, His-tagged | +Inquiry |
| HSPB9-3970HF | Recombinant Full Length Human HSPB9 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB9-5344HCL | Recombinant Human HSPB9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB9 Products
Required fields are marked with *
My Review for All HSPB9 Products
Required fields are marked with *
