Recombinant Human HTR1A protein, GST-tagged
| Cat.No. : | HTR1A-27H |
| Product Overview : | Recombinant Human HTR1A(1 a.a. - 36 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-36 a.a. |
| Description : | This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of this gene in mice results in behavior consistent with an increased anxiety and stress response. Mutation in the promoter of this gene has been associated with menstrual cycle-dependent periodic fevers. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 29.7 kDa |
| AA Sequence : | MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | HTR1A 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR1A |
| Synonyms | HTR1A; 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1A , ADRB2RL1, ADRBRL1; 5-hydroxytryptamine receptor 1A; 5 HT1A; 5-HT1a receptor; serotonin receptor 1A; G protein coupled receptor; guanine nucleotide-binding regulatory protein-coupled receptor; G-21; 5HT1a; 5-HT1A; 5-HT-1A; ADRBRL1; ADRB2RL1; |
| Gene ID | 3350 |
| mRNA Refseq | NM_000524 |
| Protein Refseq | NP_000515 |
| MIM | 109760 |
| UniProt ID | P08908 |
| Chromosome Location | 5q11.2-q13 |
| Pathway | Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Monoamine GPCRs, organism-specific biosystem; |
| Function | G-protein coupled receptor activity; drug binding; receptor activity; serotonin binding; serotonin receptor activity; signal transducer activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1A Products
Required fields are marked with *
My Review for All HTR1A Products
Required fields are marked with *
