Recombinant Human HTR2B

• Cat.No.: HTR2B-26027TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-56 of Human 5HT2B Receptor with N terminal proprietary tag; predicted MWt 31.79 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 56 amino acids
• Description: This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved.
• Molecular Weight: 31.790kDa inclusive of tags
• Tissue specificity: Detected in most peripheral organs. Only low expression levels were found in the brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: HTR2B 5-hydroxytryptamine (serotonin) receptor 2B [ Homo sapiens ]
• Official Symbol: HTR2B
• Synonyms: HTR2B; 5-hydroxytryptamine (serotonin) receptor 2B; 5-hydroxytryptamine receptor 2B; 5 HT(2B); 5 HT2B
• Gene ID: 3357
• mRNA Refseq: NM_000867
• Protein Refseq: NP_000858
• MIM: 601122
• Uniprot ID: P41595
• Chromosome Location: 2q36.3-q37.1
• Pathway: Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem
• Function: G-protein alpha-subunit binding; G-protein coupled receptor activity; Ras GTPase activator activity; calcium channel activity; drug binding