Recombinant Human HTR2B

Cat.No. : HTR2B-26027TH
Product Overview : Recombinant fragment corresponding to amino acids 1-56 of Human 5HT2B Receptor with N terminal proprietary tag; predicted MWt 31.79 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 56 amino acids
Description : This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved.
Molecular Weight : 31.790kDa inclusive of tags
Tissue specificity : Detected in most peripheral organs. Only low expression levels were found in the brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name HTR2B 5-hydroxytryptamine (serotonin) receptor 2B [ Homo sapiens ]
Official Symbol HTR2B
Synonyms HTR2B; 5-hydroxytryptamine (serotonin) receptor 2B; 5-hydroxytryptamine receptor 2B; 5 HT(2B); 5 HT2B;
Gene ID 3357
mRNA Refseq NM_000867
Protein Refseq NP_000858
MIM 601122
Uniprot ID P41595
Chromosome Location 2q36.3-q37.1
Pathway Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function G-protein alpha-subunit binding; G-protein coupled receptor activity; Ras GTPase activator activity; calcium channel activity; drug binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR2B Products

Required fields are marked with *

My Review for All HTR2B Products

Required fields are marked with *

0
cart-icon