Recombinant Human HTR2B
Cat.No. : | HTR2B-26027TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-56 of Human 5HT2B Receptor with N terminal proprietary tag; predicted MWt 31.79 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 56 amino acids |
Description : | This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved. |
Molecular Weight : | 31.790kDa inclusive of tags |
Tissue specificity : | Detected in most peripheral organs. Only low expression levels were found in the brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | HTR2B 5-hydroxytryptamine (serotonin) receptor 2B [ Homo sapiens ] |
Official Symbol | HTR2B |
Synonyms | HTR2B; 5-hydroxytryptamine (serotonin) receptor 2B; 5-hydroxytryptamine receptor 2B; 5 HT(2B); 5 HT2B; |
Gene ID | 3357 |
mRNA Refseq | NM_000867 |
Protein Refseq | NP_000858 |
MIM | 601122 |
Uniprot ID | P41595 |
Chromosome Location | 2q36.3-q37.1 |
Pathway | Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; |
Function | G-protein alpha-subunit binding; G-protein coupled receptor activity; Ras GTPase activator activity; calcium channel activity; drug binding; |
◆ Recombinant Proteins | ||
HTR2B-4375M | Recombinant Mouse HTR2B Protein, His (Fc)-Avi-tagged | +Inquiry |
HTR2B-1091HFL | Recombinant Human HTR2B protein, His&Flag-tagged | +Inquiry |
RFL5388HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 2B(Htr2B) Protein, His-Tagged | +Inquiry |
RFL33072RF | Recombinant Full Length Rat 5-Hydroxytryptamine Receptor 2B(Htr2B) Protein, His-Tagged | +Inquiry |
HTR2B-26027TH | Recombinant Human HTR2B | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR2B-5335HCL | Recombinant Human HTR2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR2B Products
Required fields are marked with *
My Review for All HTR2B Products
Required fields are marked with *