Recombinant Human HTR3B Protein

Cat.No. : HTR3B-5239H
Product Overview : Human HTR3B full-length ORF (NP_006019.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. [provided by RefSeq
Form : Liquid
Molecular Mass : 50.3 kDa
AA Sequence : MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name HTR3B 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic [ Homo sapiens ]
Official Symbol HTR3B
Synonyms HTR3B; 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3B; 5-hydroxytryptamine receptor 3B; 5 HT3B; 5-HT3-B; serotonin-gated ion channel subunit; 5-hydroxytryptamine 3 receptor B subunit; 5-HT3B;
Gene ID 9177
mRNA Refseq NM_006028
Protein Refseq NP_006019
MIM 604654
UniProt ID O95264

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR3B Products

Required fields are marked with *

My Review for All HTR3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon