Recombinant Human HTR3B Protein
| Cat.No. : | HTR3B-5239H |
| Product Overview : | Human HTR3B full-length ORF (NP_006019.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 50.3 kDa |
| AA Sequence : | MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | HTR3B 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic [ Homo sapiens ] |
| Official Symbol | HTR3B |
| Synonyms | HTR3B; 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3B; 5-hydroxytryptamine receptor 3B; 5 HT3B; 5-HT3-B; serotonin-gated ion channel subunit; 5-hydroxytryptamine 3 receptor B subunit; 5-HT3B; |
| Gene ID | 9177 |
| mRNA Refseq | NM_006028 |
| Protein Refseq | NP_006019 |
| MIM | 604654 |
| UniProt ID | O95264 |
| ◆ Cell & Tissue Lysates | ||
| HTR3B-828HCL | Recombinant Human HTR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR3B Products
Required fields are marked with *
My Review for All HTR3B Products
Required fields are marked with *



