Recombinant Human HTR4 Protein
Cat.No. : | HTR4-5238H |
Product Overview : | Human HTR4 full-length ORF (NP_000861.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR4 |
Synonyms | HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R; |
Gene ID | 3360 |
mRNA Refseq | NM_000870 |
Protein Refseq | NP_000861 |
MIM | 602164 |
UniProt ID | Q13639 |
◆ Recombinant Proteins | ||
HTR4-5237H | Recombinant Human HTR4 Protein, GST-tagged | +Inquiry |
RFL27880HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
HTR4-5694HF | Recombinant Full Length Human HTR4 Protein | +Inquiry |
RFL13015CF | Recombinant Full Length Guinea Pig 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
HTR4-2967R | Recombinant Rat HTR4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR4 Products
Required fields are marked with *
My Review for All HTR4 Products
Required fields are marked with *