Recombinant Human HTR4 protein, His-tagged
| Cat.No. : | HTR4-3817H |
| Product Overview : | Recombinant Human HTR4 protein(301-388 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-388 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR4 |
| Synonyms | HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R; |
| Gene ID | 3360 |
| mRNA Refseq | NM_000870 |
| Protein Refseq | NP_000861 |
| MIM | 602164 |
| UniProt ID | Q13639 |
| ◆ Recombinant Proteins | ||
| HTR4-2622R | Recombinant Rat HTR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HTR4-7937M | Recombinant Mouse HTR4 Protein | +Inquiry |
| RFL11110RF | Recombinant Full Length Rat 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
| RFL8363MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
| HTR4-5238H | Recombinant Human HTR4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR4 Products
Required fields are marked with *
My Review for All HTR4 Products
Required fields are marked with *
