Recombinant Human HTR4 protein, His-tagged
Cat.No. : | HTR4-3817H |
Product Overview : | Recombinant Human HTR4 protein(301-388 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301-388 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR4 |
Synonyms | HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R; |
Gene ID | 3360 |
mRNA Refseq | NM_000870 |
Protein Refseq | NP_000861 |
MIM | 602164 |
UniProt ID | Q13639 |
◆ Recombinant Proteins | ||
HTR4-5237H | Recombinant Human HTR4 Protein, GST-tagged | +Inquiry |
HTR4-2967R | Recombinant Rat HTR4 Protein | +Inquiry |
HTR4-5696HF | Recombinant Full Length Human HTR4 Protein, GST-tagged | +Inquiry |
HTR4-3817H | Recombinant Human HTR4 protein, His-tagged | +Inquiry |
RFL8363MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR4 Products
Required fields are marked with *
My Review for All HTR4 Products
Required fields are marked with *
0
Inquiry Basket