Recombinant Human HTR4 Protein, GST-tagged
| Cat.No. : | HTR4-5237H |
| Product Overview : | Human HTR4 full-length ORF ( NP_000861.1, 1 a.a. - 388 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq |
| Molecular Mass : | 70.2 kDa |
| AA Sequence : | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR4 |
| Synonyms | HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R; |
| Gene ID | 3360 |
| mRNA Refseq | NM_000870 |
| Protein Refseq | NP_000861 |
| MIM | 602164 |
| UniProt ID | Q13639 |
| ◆ Recombinant Proteins | ||
| HTR4-3817H | Recombinant Human HTR4 protein, His-tagged | +Inquiry |
| HTR4-5694HF | Recombinant Full Length Human HTR4 Protein | +Inquiry |
| HTR4-5238H | Recombinant Human HTR4 Protein | +Inquiry |
| RFL8363MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
| HTR4-2622R | Recombinant Rat HTR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR4 Products
Required fields are marked with *
My Review for All HTR4 Products
Required fields are marked with *



