Recombinant Human HTR5A protein, GST-tagged

Cat.No. : HTR5A-301334H
Product Overview : Recombinant Human HTR5A (182-282 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly182-Arg282
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name HTR5A 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [ Homo sapiens ]
Official Symbol HTR5A
Synonyms HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; 5-HT-5; 5-HT-5A; serotonin receptor 5A; 5-HT5A; MGC138226;
Gene ID 3361
mRNA Refseq NM_024012
Protein Refseq NP_076917
MIM 601305
UniProt ID P47898

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR5A Products

Required fields are marked with *

My Review for All HTR5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon