Recombinant Human HTR5A protein, GST-tagged
Cat.No. : | HTR5A-301334H |
Product Overview : | Recombinant Human HTR5A (182-282 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly182-Arg282 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | HTR5A 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR5A |
Synonyms | HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; 5-HT-5; 5-HT-5A; serotonin receptor 5A; 5-HT5A; MGC138226; |
Gene ID | 3361 |
mRNA Refseq | NM_024012 |
Protein Refseq | NP_076917 |
MIM | 601305 |
UniProt ID | P47898 |
◆ Recombinant Proteins | ||
HTR5A-242HF | Recombinant Full Length Human HTR5A Protein | +Inquiry |
HTR5A-2194H | Recombinant Human HTR5A Protein, MYC/DDK-tagged | +Inquiry |
RFL28430MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged | +Inquiry |
HTR5A-7938M | Recombinant Mouse HTR5A Protein | +Inquiry |
RFL32294HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR5A Products
Required fields are marked with *
My Review for All HTR5A Products
Required fields are marked with *