Recombinant Human HTR5A
Cat.No. : | HTR5A-26029TH |
Product Overview : | Recombinant full length Human 5HT5A receptor (aa 1-357) with N terminal proprietary tag, 65.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 357 amino acids |
Description : | The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. |
Molecular Weight : | 65.340kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFG VLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVA SMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNV MIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWK SIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | HTR5A 5-hydroxytryptamine (serotonin) receptor 5A [ Homo sapiens ] |
Official Symbol | HTR5A |
Synonyms | HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A; |
Gene ID | 3361 |
mRNA Refseq | NM_024012 |
Protein Refseq | NP_076917 |
MIM | 601305 |
Uniprot ID | P47898 |
Chromosome Location | 7q36.1 |
Pathway | Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; |
Function | G-protein coupled receptor activity; receptor activity; serotonin receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
HTR5A-5235H | Recombinant Human HTR5A Protein, GST-tagged | +Inquiry |
HTR5A-2623R | Recombinant Rat HTR5A Protein, His (Fc)-Avi-tagged | +Inquiry |
HTR5A-5699HF | Recombinant Full Length Human HTR5A Protein, GST-tagged | +Inquiry |
HTR5A-1997R | Recombinant Rhesus Macaque HTR5A Protein, His (Fc)-Avi-tagged | +Inquiry |
Htr5a-1196M | Recombinant Mouse Htr5a Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR5A Products
Required fields are marked with *
My Review for All HTR5A Products
Required fields are marked with *