Recombinant Human HYAL4 Protein, GST-tagged
| Cat.No. : | HYAL4-5218H |
| Product Overview : | Human HYAL4 partial ORF ( NP_036401.1, 357 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HYAL4 hyaluronoglucosaminidase 4 [ Homo sapiens ] |
| Official Symbol | HYAL4 |
| Synonyms | HYAL4; hyaluronoglucosaminidase 4; hyaluronidase-4; hyaluronidase 4; hyal-4; hyaluronoglucosaminidase-4; chondroitin sulfate hydrolase; CSHY; |
| Gene ID | 23553 |
| mRNA Refseq | NM_012269 |
| Protein Refseq | NP_036401 |
| MIM | 604510 |
| UniProt ID | Q2M3T9 |
| ◆ Recombinant Proteins | ||
| HYAL4-14021H | Recombinant Human HYAL4, GST-tagged | +Inquiry |
| HYAL4-5218H | Recombinant Human HYAL4 Protein, GST-tagged | +Inquiry |
| HYAL4-1973H | Active Recombinant Human Hyaluronoglucosaminidase 4, His-tagged | +Inquiry |
| HYAL4-795H | Recombinant Human HYAL4 protein, His-tagged | +Inquiry |
| HYAL4-7955M | Recombinant Mouse HYAL4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYAL4 Products
Required fields are marked with *
My Review for All HYAL4 Products
Required fields are marked with *
