Recombinant Human HYAL4 Protein, GST-tagged

Cat.No. : HYAL4-5218H
Product Overview : Human HYAL4 partial ORF ( NP_036401.1, 357 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HYAL4 hyaluronoglucosaminidase 4 [ Homo sapiens ]
Official Symbol HYAL4
Synonyms HYAL4; hyaluronoglucosaminidase 4; hyaluronidase-4; hyaluronidase 4; hyal-4; hyaluronoglucosaminidase-4; chondroitin sulfate hydrolase; CSHY;
Gene ID 23553
mRNA Refseq NM_012269
Protein Refseq NP_036401
MIM 604510
UniProt ID Q2M3T9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYAL4 Products

Required fields are marked with *

My Review for All HYAL4 Products

Required fields are marked with *

0
cart-icon