Recombinant Human HYOU1 Protein, GST-tagged
| Cat.No. : | HYOU1-5215H |
| Product Overview : | Human HYOU1 full-length ORF ( AAH04560.1, 36 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5 UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. [provided by RefSeq |
| Molecular Mass : | 38.06 kDa |
| AA Sequence : | MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HYOU1 hypoxia up-regulated 1 [ Homo sapiens ] |
| Official Symbol | HYOU1 |
| Synonyms | HYOU1; hypoxia up-regulated 1; hypoxia up-regulated protein 1; glucose regulated protein 170; Grp170; HSP12A; ORP150; glucose-regulated protein 170; 150 kDa oxygen-regulated protein; oxygen regulated protein (150kD); 170 kDa glucose-regulated protein; GRP-170; ORP-150; FLJ94899; FLJ97572; DKFZp686N08236; |
| Gene ID | 10525 |
| mRNA Refseq | NM_001130991 |
| Protein Refseq | NP_001124463 |
| MIM | 601746 |
| UniProt ID | Q9Y4L1 |
| ◆ Recombinant Proteins | ||
| HYOU1-2743H | Recombinant Human HYOU1 Protein (Met695-Leu994), N-His tagged | +Inquiry |
| HYOU1-4395M | Recombinant Mouse HYOU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HYOU1-5215H | Recombinant Human HYOU1 Protein, GST-tagged | +Inquiry |
| HYOU1-2742H | Recombinant Human HYOU1 Protein (Met695-Leu999), C-10×His tagged | +Inquiry |
| HYOU1-11978Z | Recombinant Zebrafish HYOU1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HYOU1-2295HCL | Recombinant Human HYOU1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYOU1 Products
Required fields are marked with *
My Review for All HYOU1 Products
Required fields are marked with *
