Recombinant Human ICAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ICAM4-4077H |
Product Overview : | ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens (human) ] |
Official Symbol | ICAM4 |
Synonyms | ICAM4; intercellular adhesion molecule 4 (Landsteiner-Wiener blood group); intercellular adhesion molecule 4 (LW blood group), intercellular adhesion molecule 4, Landsteiner Wiener blood group, Landsteiner Wiener blood group, LW; intercellular adhesion molecule 4; CD242; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group); LW; |
Gene ID | 3386 |
mRNA Refseq | NM_001039132 |
Protein Refseq | NP_001034221 |
MIM | 614088 |
UniProt ID | Q14773 |
◆ Recombinant Proteins | ||
ICAM4-1255H | Recombinant Human ICAM4 Protein (Met52-Trp234), N-His tagged | +Inquiry |
Icam4-7128M | Recombinant Mouse Icam4 protein, His & T7-tagged | +Inquiry |
Icam4-4877M | Recombinant Mouse Icam4 protein, His-SUMO-tagged | +Inquiry |
ICAM4-1620R | Recombinant Rhesus Monkey ICAM4 Protein, hIgG1-tagged | +Inquiry |
Icam4-7129R | Recombinant Rat Icam4 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICAM4-943HCL | Recombinant Human ICAM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICAM4 Products
Required fields are marked with *
My Review for All ICAM4 Products
Required fields are marked with *