"ID1" Related Products

Expand
Expand

Recombinant Human ID1 protein, Arginine-tagged

Cat.No.: ID1-146H
Product Overview: Recombinant human ID1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: KVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRL KELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDR ILCRLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for epithelial cells in vitro cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ID1 inhibitor of DNA binding 1, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol: ID1
Synonyms: ID1; dJ857M17.1.2; DNA binding protein inhibitor ID 1; inhibitor of differentiation 1; class B basic helix-loop-helix protein 24;
Gene ID: 3397
mRNA Refseq: NM_002165
Protein Refseq: NP_002156
MIM: 600349
UniProt ID: P41134
Chromosome Location: 20q11
Pathway: ALK1 signaling events, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.