Recombinant Human ID1 protein, Arginine-tagged
| Cat.No. : | ID1-146H |
| Product Overview : | Recombinant human ID1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | KVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRL KELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDR ILCRLEESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein transduction for epithelial cells in vitro cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | ID1 inhibitor of DNA binding 1, dominant negative helix-loop-helix protein [ Homo sapiens ] |
| Official Symbol | ID1 |
| Synonyms | ID1; dJ857M17.1.2; DNA binding protein inhibitor ID 1; inhibitor of differentiation 1; class B basic helix-loop-helix protein 24; |
| Gene ID | 3397 |
| mRNA Refseq | NM_002165 |
| Protein Refseq | NP_002156 |
| MIM | 600349 |
| UniProt ID | P41134 |
| Chromosome Location | 20q11 |
| Pathway | ALK1 signaling events, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| ID1-3219H | Recombinant Human ID1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ID1-2009R | Recombinant Rhesus Macaque ID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ID1-1131H | Recombinant Human ID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ID1-146H | Recombinant Human ID1 protein, Arginine-tagged | +Inquiry |
| ID1-3062H | Recombinant Human ID1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ID1-5312HCL | Recombinant Human ID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ID1 Products
Required fields are marked with *
My Review for All ID1 Products
Required fields are marked with *



