"ID1" Related Products

Expand
Expand

Recombinant Human ID1 protein, Arginine-tagged

Cat.No. : ID1-146H
Product Overview : Recombinant human ID1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source : E. coli
Species : Human
Tag : Arginine
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : KVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRL KELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDR ILCRLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for epithelial cells in vitro cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name : ID1 inhibitor of DNA binding 1, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol : ID1
Synonyms : ID1; dJ857M17.1.2; DNA binding protein inhibitor ID 1; inhibitor of differentiation 1; class B basic helix-loop-helix protein 24;
Gene ID : 3397
mRNA Refseq : NM_002165
Protein Refseq : NP_002156
MIM : 600349
UniProt ID : P41134
Chromosome Location : 20q11
Pathway : ALK1 signaling events, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.