Recombinant Human ID2 protein, His-SUMO-tagged
| Cat.No. : | ID2-3063H |
| Product Overview : | Recombinant Human ID2 protein(Q02363)(1-134aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-134aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.9 kDa |
| AA Sequence : | MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ID2 inhibitor of DNA binding 2, dominant negative helix-loop-helix protein [ Homo sapiens ] |
| Official Symbol | ID2 |
| Synonyms | ID2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-2; bHLHb26; cell growth inhibiting gene 8; GIG8; helix-loop-helix protein ID2; cell growth-inhibiting gene 8; inhibitor of differentiation 2; DNA-binding protein inhibitor ID2; class B basic helix-loop-helix protein 26; ID2A; ID2H; MGC26389; |
| Gene ID | 3398 |
| mRNA Refseq | NM_002166 |
| Protein Refseq | NP_002157 |
| MIM | 600386 |
| UniProt ID | Q02363 |
| ◆ Recombinant Proteins | ||
| ID2-28380TH | Recombinant Human ID2 | +Inquiry |
| ID2-7980M | Recombinant Mouse ID2 Protein | +Inquiry |
| ID2-245HF | Active Recombinant Full Length Human ID2 Protein | +Inquiry |
| ID2-2982R | Recombinant Rat ID2 Protein | +Inquiry |
| ID2-4406M | Recombinant Mouse ID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ID2-5311HCL | Recombinant Human ID2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ID2 Products
Required fields are marked with *
My Review for All ID2 Products
Required fields are marked with *
