Recombinant Human IDH2, His-tagged
Cat.No. : | IDH2-28080TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 217-442 of Human IDH2 with an N terminal His tag; MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 217-442 a.a. |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILK AYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMV AQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTS VLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIA SIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGA MTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIK |
Sequence Similarities : | Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
Gene Name | IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ] |
Official Symbol | IDH2 |
Synonyms | IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; |
Gene ID | 3418 |
mRNA Refseq | NM_002168 |
Protein Refseq | NP_002159 |
MIM | 147650 |
Uniprot ID | P48735 |
Chromosome Location | 15q21-qter |
Pathway | Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => |
Function | NAD binding; isocitrate dehydrogenase (NADP+) activity; isocitrate dehydrogenase (NADP+) activity; magnesium ion binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
IDH2-3239C | Recombinant Chicken IDH2 | +Inquiry |
IDH2-994H | Recombinant Human IDH2 Protein, His-tagged | +Inquiry |
IDH2-2835H | Recombinant Human IDH2 protein, His-tagged | +Inquiry |
IDH2-045H | Recombinant Human IDH2 Protein, MYC/DDK-tagged | +Inquiry |
IDH2-28080TH | Recombinant Human IDH2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH2-5306HCL | Recombinant Human IDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH2 Products
Required fields are marked with *
My Review for All IDH2 Products
Required fields are marked with *
0
Inquiry Basket