Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IDH2, His-tagged

Cat.No. : IDH2-28080TH
Product Overview : Recombinant fragment, corresponding to amino acids 217-442 of Human IDH2 with an N terminal His tag; MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILK AYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMV AQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTS VLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIA SIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGA MTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIK
Sequence Similarities : Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Gene Name : IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ]
Official Symbol : IDH2
Synonyms : IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial;
Gene ID : 3418
mRNA Refseq : NM_002168
Protein Refseq : NP_002159
MIM : 147650
Uniprot ID : P48735
Chromosome Location : 15q21-qter
Pathway : Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function : NAD binding; isocitrate dehydrogenase (NADP+) activity; isocitrate dehydrogenase (NADP+) activity; magnesium ion binding; oxidoreductase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends