Recombinant Human IDH2, His-tagged

Cat.No. : IDH2-28080TH
Product Overview : Recombinant fragment, corresponding to amino acids 217-442 of Human IDH2 with an N terminal His tag; MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 217-442 a.a.
Description : Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILK AYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMV AQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTS VLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIA SIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGA MTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIK
Sequence Similarities : Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Gene Name IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ]
Official Symbol IDH2
Synonyms IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial;
Gene ID 3418
mRNA Refseq NM_002168
Protein Refseq NP_002159
MIM 147650
Uniprot ID P48735
Chromosome Location 15q21-qter
Pathway Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function NAD binding; isocitrate dehydrogenase (NADP+) activity; isocitrate dehydrogenase (NADP+) activity; magnesium ion binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IDH2 Products

Required fields are marked with *

My Review for All IDH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon