Recombinant Human IDH2, His-tagged

• Cat.No.: IDH2-28080TH
• Product Overview: Recombinant fragment, corresponding to amino acids 217-442 of Human IDH2 with an N terminal His tag; MWt 26 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 217-442 a.a.
• Description: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 87 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILK AYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMV AQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTS VLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIA SIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGA MTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIK
• Sequence Similarities: Belongs to the isocitrate and isopropylmalate dehydrogenases family.

Gene Information

• Gene Name: IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ]
• Official Symbol: IDH2
• Synonyms: IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial
• Gene ID: 3418
• mRNA Refseq: NM_002168
• Protein Refseq: NP_002159
• MIM: 147650
• Uniprot ID: P48735
• Chromosome Location: 15q21-qter
• Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
• Function: NAD binding; isocitrate dehydrogenase (NADP+) activity; isocitrate dehydrogenase (NADP+) activity; magnesium ion binding; oxidoreductase activity