Recombinant Human IDH2 Protein, GST-tagged

• Cat.No.: IDH2-3098H
• Product Overview: Recombinant Human IDH2 Protein(394-452 aa), fused with N-terminal GST Tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 394-452 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AASequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ]
• Official Symbol: IDH2
• Synonyms: IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; NADP(+)-specific ICDH; oxalosuccinate decarboxylase; IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH
• Gene ID: 3418
• mRNA Refseq: NM_002168
• Protein Refseq: NP_002159
• MIM: 147650
• UniProt ID: P48735