Recombinant Human IDO2 protein, His-tagged
Cat.No. : | IDO2-2547H |
Product Overview : | Recombinant Human IDO2 protein(268-420 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 268-420 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | IDO2 indoleamine 2,3-dioxygenase 2 [ Homo sapiens ] |
Official Symbol | IDO2 |
Synonyms | IDO2; indoleamine 2,3-dioxygenase 2; INDOL1, indoleamine pyrrole 2,3 dioxygenase like 1; IDO-2; indoleamine 2,3-dioxygenase-like 1 protein; indoleamine 2,3-dioxygenase-like protein 1; indoleamine-pyrrole 2,3 dioxygenase-like 1; indoleamine-pyrrole 2,3-dioxygenase-like protein 1; INDOL1; |
mRNA Refseq | NM_194294 |
Protein Refseq | NP_919270 |
MIM | 612129 |
UniProt ID | Q6ZQW0 |
Gene ID | 169355 |
◆ Recombinant Proteins | ||
IDO2-3065H | Recombinant Human IDO2 protein, His-SUMO-tagged | +Inquiry |
Ido2-3475M | Recombinant Mouse Ido2 Protein, Myc/DDK-tagged | +Inquiry |
IDO2-557H | Recombinant Human IDO2 Protein, His-tagged | +Inquiry |
IDO2-0255H | Recombinant Human IDO2 protein, His-tagged | +Inquiry |
IDO2-2547H | Recombinant Human IDO2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDO2-5299HCL | Recombinant Human IDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDO2 Products
Required fields are marked with *
My Review for All IDO2 Products
Required fields are marked with *