Recombinant Human IFI30 protein, His-tagged
Cat.No. : | IFI30-7855H |
Product Overview : | Recombinant Human IFI30 protein(P13284)(1-232aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-232aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK |
Gene Name | IFI30 interferon, gamma-inducible protein 30 [ Homo sapiens ] |
Official Symbol | IFI30 |
Synonyms | IFI30; interferon, gamma-inducible protein 30; GILT; IP30; IFI-30; gamma-interferon-inducible lysosomal thiol reductase; legumaturain; gamma-interferon-inducible protein IP-30; interferon gamma-inducible protein 30 preproprotein; MGC32056; EC 1.8; Legumaturain |
Gene ID | 10437 |
mRNA Refseq | NM_006332 |
Protein Refseq | NP_006323 |
MIM | 604664 |
UniProt ID | P13284 |
◆ Recombinant Proteins | ||
IFI30-1567Z | Recombinant Zebrafish IFI30 | +Inquiry |
IFI30-468H | Recombinant Human IFI30 Protein, His-tagged | +Inquiry |
IFI30-7185H | Recombinant Human Interferon, Gamma-Inducible Protein 30, His-tagged | +Inquiry |
IFI30-7855H | Recombinant Human IFI30 protein, His-tagged | +Inquiry |
IFI30-3785H | Recombinant Human IFI30 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI30-1503HCL | Recombinant Human IFI30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI30 Products
Required fields are marked with *
My Review for All IFI30 Products
Required fields are marked with *