Recombinant Human IFI44 protein, GST-tagged
Cat.No. : | IFI44-3728H |
Product Overview : | Recombinant Human IFI44 protein(9-175 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 9-175 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | RLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IFI44 interferon-induced protein 44 [ Homo sapiens ] |
Official Symbol | IFI44 |
Synonyms | IFI44; interferon-induced protein 44; MTAP44; p44; microtubule-associated protein 44; interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD); |
Gene ID | 10561 |
mRNA Refseq | NM_006417 |
Protein Refseq | NP_006408 |
MIM | 610468 |
UniProt ID | Q8TCB0 |
◆ Recombinant Proteins | ||
IFI44-3060H | Recombinant Human IFI44 protein, His-tagged | +Inquiry |
IFI44-8011M | Recombinant Mouse IFI44 Protein | +Inquiry |
IFI44-2653H | Recombinant Human IFI44 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFI44-4430M | Recombinant Mouse IFI44 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ifi44-3478M | Recombinant Mouse Ifi44 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI44-5292HCL | Recombinant Human IFI44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFI44 Products
Required fields are marked with *
My Review for All IFI44 Products
Required fields are marked with *
0
Inquiry Basket