Recombinant Human IFI6 Protein (24-130 aa), His-B2M-tagged
| Cat.No. : | IFI6-2182H |
| Product Overview : | Recombinant Human IFI6 Protein (24-130 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 24-130 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.4 kDa |
| AA Sequence : | GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | IFI6 interferon alpha inducible protein 6 [ Homo sapiens (human) ] |
| Official Symbol | IFI6 |
| Synonyms | 6-16; G1P3; FAM14C; IFI616; IFI-6-16; |
| Gene ID | 2537 |
| mRNA Refseq | NM_002038 |
| Protein Refseq | NP_002029 |
| UniProt ID | P09912 |
| ◆ Cell & Tissue Lysates | ||
| IFI6-5291HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
| IFI6-5290HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI6 Products
Required fields are marked with *
My Review for All IFI6 Products
Required fields are marked with *
