Recombinant Full Length Human Interferon Alpha-Inducible Protein 6(Ifi6) Protein, His-Tagged
Cat.No. : | RFL34962HF |
Product Overview : | Recombinant Full Length Human Interferon alpha-inducible protein 6(IFI6) Protein (P09912) (24-130aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-130) |
Form : | Lyophilized powder |
AA Sequence : | GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILN GGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IFI6 |
Synonyms | Ifi-6-16; IFI6; IFI6_HUMAN; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16 |
UniProt ID | P09912 |
◆ Recombinant Proteins | ||
RFL1472BF | Recombinant Full Length Bovine Interferon Alpha-Inducible Protein 6(Ifi6) Protein, His-Tagged | +Inquiry |
IFI6-1422H | Recombinant Human IFI6 Protein (24-130 aa), His-tagged | +Inquiry |
IFI6-5102HF | Recombinant Full Length Human IFI6 Protein, GST-tagged | +Inquiry |
IFI6-4608H | Recombinant Human IFI6 Protein, GST-tagged | +Inquiry |
IFI6-2200R | Recombinant Rhesus monkey IFI6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI6-5290HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
IFI6-5291HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFI6 Products
Required fields are marked with *
My Review for All IFI6 Products
Required fields are marked with *
0
Inquiry Basket