Recombinant Human IFI6 Protein (24-130 aa), His-tagged

• Cat.No.: IFI6-1422H
• Product Overview: Recombinant Human IFI6 Protein (24-130 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 24-130 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.4 kDa
• AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: IFI6 interferon, alpha-inducible protein 6 [ Homo sapiens ]
• Official Symbol: IFI6
• Synonyms: IFI6; FAM14C; IFI 6 16; IFI616; 6-16; G1P3; IFI-6-16
• Gene ID: 2537
• mRNA Refseq: NM_002038
• Protein Refseq: NP_002029
• MIM: 147572
• UniProt ID: P09912