Recombinant Human IFI6 Protein (24-130 aa), His-tagged
Cat.No. : | IFI6-1422H |
Product Overview : | Recombinant Human IFI6 Protein (24-130 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-130 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 12.4 kDa |
AA Sequence : | GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | IFI6 interferon, alpha-inducible protein 6 [ Homo sapiens ] |
Official Symbol | IFI6 |
Synonyms | IFI6; FAM14C; IFI 6 16; IFI616; 6-16; G1P3; IFI-6-16; |
Gene ID | 2537 |
mRNA Refseq | NM_002038 |
Protein Refseq | NP_002029 |
MIM | 147572 |
UniProt ID | P09912 |
◆ Cell & Tissue Lysates | ||
IFI6-5291HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
IFI6-5290HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI6 Products
Required fields are marked with *
My Review for All IFI6 Products
Required fields are marked with *
0
Inquiry Basket