Recombinant Human IFNA2 protein, His-KSI-tagged
Cat.No. : | IFNA2-7554H |
Product Overview : | Recombinant Human IFNA2 protein(P01563)(24-188aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 24-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens ] |
Official Symbol | IFNA2 |
Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
Gene ID | 3440 |
mRNA Refseq | NM_000605 |
Protein Refseq | NP_000596 |
MIM | 147562 |
UniProt ID | P01563 |
◆ Recombinant Proteins | ||
IFNA2-72C | Recombinant Cynomolgus IFNA2, His tagged | +Inquiry |
IFNA2-02H | Recombinant Human Pegylated Interferon Alpha-2a | +Inquiry |
IFNA2-106I | Active Recombinant Human IFNA2B Protein (165 aa) | +Inquiry |
IFNA2-1261H | Acitve Recombinant Human IFNA2 protein(Cys24-Glu188) | +Inquiry |
IFNA2-8830C | Recombinant Cynomolgus IFNA2, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket