Cat.No. :	IFNA21-1424H
Product Overview :	Recombinant Human IFNA21 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
Description :	Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Source :	Yeast
Species :	Human
Tag :	His
Form :	Tris-based buffer,50% glycerol
Molecular Mass :	21.3 kDa
Protein length :	24-189 aa
AA Sequence :	CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Purity :	> 90% as determined by SDS-PAGE.
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage :	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration :	A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Name :	IFNA21 interferon, alpha 21 [ Homo sapiens ]
Official Symbol :	IFNA21
Synonyms :	IFNA21; IFN alphaI; IFN-alpha-21; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689;
Gene ID :	3452
mRNA Refseq :	NM_002175
Protein Refseq :	NP_002166
MIM :	147584
UniProt ID :	P01568

Online Inquiry