Recombinant Human IFNA21 Protein (24-189 aa), His-tagged

• Cat.No.: IFNA21-1424H
• Product Overview: Recombinant Human IFNA21 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 24-189 aa
• Description: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.3 kDa
• AA Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: IFNA21 interferon, alpha 21 [ Homo sapiens ]
• Official Symbol: IFNA21
• Synonyms: IFNA21; IFN alphaI; IFN-alpha-21; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689
• Gene ID: 3452
• mRNA Refseq: NM_002175
• Protein Refseq: NP_002166
• MIM: 147584
• UniProt ID: P01568