Recombinant Human IFNA21 Protein (24-189 aa), His-tagged

Cat.No. : IFNA21-1424H
Product Overview : Recombinant Human IFNA21 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 24-189 aa
Description : Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.3 kDa
AA Sequence : CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name IFNA21 interferon, alpha 21 [ Homo sapiens ]
Official Symbol IFNA21
Synonyms IFNA21; IFN alphaI; IFN-alpha-21; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689;
Gene ID 3452
mRNA Refseq NM_002175
Protein Refseq NP_002166
MIM 147584
UniProt ID P01568

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNA21 Products

Required fields are marked with *

My Review for All IFNA21 Products

Required fields are marked with *

0
cart-icon