Recombinant Human IFNA21 Protein (24-189 aa), His-tagged
Cat.No. : | IFNA21-1424H |
Product Overview : | Recombinant Human IFNA21 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-189 aa |
Description : | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.3 kDa |
AA Sequence : | CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | IFNA21 interferon, alpha 21 [ Homo sapiens ] |
Official Symbol | IFNA21 |
Synonyms | IFNA21; IFN alphaI; IFN-alpha-21; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689; |
Gene ID | 3452 |
mRNA Refseq | NM_002175 |
Protein Refseq | NP_002166 |
MIM | 147584 |
UniProt ID | P01568 |
◆ Recombinant Proteins | ||
IFNA21-77H | Recombinant Human Interferon, Alpha 21 | +Inquiry |
IFNA21-6275H | Recombinant Human IFNA21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFNA21-3069H | Recombinant Human IFNA21 protein, His-tagged | +Inquiry |
IFNA21-1424H | Recombinant Human IFNA21 Protein (24-189 aa), His-tagged | +Inquiry |
IFNA21-617H | Recombinant Human IFNA21 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA21-5280HCL | Recombinant Human IFNA21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA21 Products
Required fields are marked with *
My Review for All IFNA21 Products
Required fields are marked with *
0
Inquiry Basket