Recombinant Human IFNA6 protein, His&Myc-tagged
Cat.No. : | IFNA6-3071H |
Product Overview : | Recombinant Human IFNA6 protein(P05013)(21-189aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IFNA6 interferon, alpha 6 [ Homo sapiens ] |
Official Symbol | IFNA6 |
Synonyms | IFNA6; interferon, alpha 6; interferon alpha-6; IFN alphaK; leIF K; IFN-alpha-6; interferon alpha-K; interferon alpha-54; IFN-alphaK; |
Gene ID | 3443 |
mRNA Refseq | NM_021002 |
Protein Refseq | NP_066282 |
MIM | 147566 |
UniProt ID | P05013 |
◆ Recombinant Proteins | ||
IFNA6-195H | Recombinant Human IFNA6 Protein, His-tagged | +Inquiry |
IFNA6-81H | Recombinant Human Interferon, Alpha 6 | +Inquiry |
IFNA6-20HFL | Active Recombinant Human Full Length IFNA6 Protein | +Inquiry |
IFNA6-3071H | Recombinant Human IFNA6 protein, His&Myc-tagged | +Inquiry |
IFNA6-079H | Recombinant Human IFNA6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA6-5279HCL | Recombinant Human IFNA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA6 Products
Required fields are marked with *
My Review for All IFNA6 Products
Required fields are marked with *