Recombinant Human IFNB1 therapeutic protein(Interferon beta-1b)
Cat.No. : | IFNB1-P022H |
Product Overview : | Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 165aa |
Description : | This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. |
Molecular Mass : | 20.0kDa |
AA Sequence : | MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFR QDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCA WTIVRVEILRNFYFINRLTGYLRN |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | IFNB1; IFNB; IFB; IFF; IFN-beta; Interferon beta-1b |
Gene Name | IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ] |
Official Symbol | IFNB1 |
Synonyms | IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956; |
Gene ID | 3456 |
mRNA Refseq | NM_002176 |
Protein Refseq | NP_002167 |
MIM | 147640 |
UniProt ID | P01574 |
Chromosome Location | 9p22 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; |
Function | cytokine activity; interferon-alpha/beta receptor binding; transcription corepressor activity; |
◆ Recombinant Proteins | ||
IFNB1-2024R | Active Recombinant Rhesus IFNB1 protein, mFc-tagged | +Inquiry |
IFNB1-93H | Active Recombinant Human Iinterferon, Beta 1, Fibroblast | +Inquiry |
IFNB1-2206R | Recombinant Rhesus monkey IFNB1 Protein, His-tagged | +Inquiry |
IFNB1-66S | Active Recombinant Swine Interferon Beta | +Inquiry |
IFNB1-496M | Recombinant Mouse IFNB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *